PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000879799
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family LBD
Protein Properties Length: 233aa    MW: 25232.4 Da    PI: 6.3336
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000879799genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.63.7e-42771761100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkCa++Cvlapyfp ++p kf ++h++FGasn++kll+++pe++r da+ss+vyeA+ar++dPvyG++g i++lq+q+ +l+a+la+
  MDP0000879799  77 PCAACKILRRKCAEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQEIPESHRADAVSSMVYEANARIHDPVYGCAGAIFQLQKQVGELQAQLAK 172
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  MDP0000879799 173 TQAE 176
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.70976177IPR004883Lateral organ boundaries, LOB
PfamPF031958.6E-4277174IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEFDAKTATT TTSTASLPPP FSYSPSSTSS PSTASFPFPN SQHLSNYLSP HASNSNIATN  60
PFPTSPSPPP APVILSPCAA CKILRRKCAE KCVLAPYFPP TEPLKFTIAH RVFGASNIIK  120
LLQEIPESHR ADAVSSMVYE ANARIHDPVY GCAGAIFQLQ KQVGELQAQL AKTQAELVNM  180
QCQQGNLIAL ICMDMXQSKE QAILQQQQSN NIDTSCFLDE NNLGTAWEPL WT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369398.11e-171PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5X5X51e-103M5X5X5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04350.15e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.17e-71LOB domain-containing protein 1